PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10005739
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 267aa    MW: 29756.3 Da    PI: 6.0906
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10005739genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.32e-141562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEd +l  +++q G  +W+t++   g+ R +k+c++rw +yl
      Lus10005739 15 RGLWSPEEDHRLRSYIAQNGHSCWTTVPINAGLQRNGKSCRLRWINYL 62
                     788*******************************************97 PP

2Myb_DNA-binding44.24.4e-1468113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++ E++ ++ ++++lG++ W+ Iar+++ gRt++++k+ w++yl
      Lus10005739  68 RGLFSAHEEDTILTLHRLLGNK-WSQIARHLP-GRTDNEIKNCWHSYL 113
                      7889******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.8271062IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-191065IPR009057Homeodomain-like
SuperFamilySSF466892.44E-2613109IPR009057Homeodomain-like
SMARTSM007173.6E-81464IPR001005SANT/Myb domain
PfamPF002491.5E-121562IPR001005SANT/Myb domain
CDDcd001671.28E-71862No hitNo description
PROSITE profilePS5129423.36663117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2366117IPR009057Homeodomain-like
SMARTSM007175.0E-1467115IPR001005SANT/Myb domain
PfamPF002494.3E-1268113IPR001005SANT/Myb domain
CDDcd001671.14E-1071113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MEECRTQKPK LKLRRGLWSP EEDHRLRSYI AQNGHSCWTT VPINAGLQRN GKSCRLRWIN  60
YLRPGLKRGL FSAHEEDTIL TLHRLLGNKW SQIARHLPGR TDNEIKNCWH SYLSKKILKI  120
PDNKKLSASY SPAESPPSTT ADQPSNNITS NSMAQDKGSS RPLLPPNLMF AEWLSVDGFA  180
AAMSAAEPLF CSDEGFASGS DEFGLDIPVS ELFDENLMMT TSDASGASDM FSSSQFGFGD  240
PSMDSGDQFV EFCSDFHFNS DHAMYM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-21131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1744470.0JX174447.1 Linum usitatissimum clone LuBAC375N24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007038672.12e-73Myb domain protein 18, putative
TrEMBLA0A061G1E13e-73A0A061G1E1_THECC; Myb domain protein 18, putative
STRINGPOPTR_0012s13260.18e-70(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38303161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.12e-58myb domain protein 19